<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA631 CA1203 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+DDC 78
3 D4T 17
4 DDI 13
5 3TC+AZT+SQV 30
6 3TC+AZT+IDV 21
7 3TC+D4T+SQV+RTV 75

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219N     E6D, V35X, T39A, E44D, V118I, K173T, E203K, Q207D, H208Y, R211K  
>CA1203| codons 1-233
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALXEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELRDYLWKWGFYTPDNKHQKEPPFLWMGYE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M F53FL, G73S L10I, K20R, E35D, M36I, N37D, Q61E, I62V, L63P, A71T, I72K, V77I, I93L  
>CA1202| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKIIGGIGGLIKVRQYD
EVPIEICGHKTKSTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005