<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA478 CA11965 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 AZT+DDI 386
3 3TC+D4T+NVP 62

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M, M184MV V75I, F77L, F116Y, K219KE K103KN, Y181YC   V35I, T39A, V60VI, S68G, E79D, R83K, V90I, A158S, I202IV, R211K, D218DE, H221HY, L228LR, V245E, R284K, T286A, E297A K281KE
>CA11965| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPI
FAIKRKDGTRWRKLIDLRDLNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPSIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPEEKYQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCELLKGAKALTEVIPLTAEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P  
>CA12057| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005