<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4850 CA11941 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 48
2 DDI 57
3 3TC+AZT+D4T 44
4 3TC+AZT+NVP+RTV 26
5 3TC+AZT+NFV 44
6 D4T+DDI+NVP 43
7 3TC+AZT+DDI+EFV+IDV+RTV 39

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L210W, T215F K219Q L100LI, Y188L   M16V, V35L, T39A, K43KN, K122E, T139TA, G196E, Q207E, L228H, V245E, A272P, T286A, E297R  
>CA11941| codons 1-302
PISPIETVPVKLKPGVDGPKVKQWPLTEEKIKALLEICAELENEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIEQHRTKIEELREHLWRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTREAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   L10I, I62V, L63P, A71V, I72V, V77I, I93L  
>CA12030| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVVGTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005