<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1419 CA11940 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 DDI 13
3 AZT+DDI 35
4 3TC+AZT 56
5 3TC+AZT+SQV 17
6 3TC+AZT+IDV 39
7 D4T+NFV 48
8 D4T+DDC+NVP 20
9 DDI+RTV+SQV 24
10 ABC+EFV 16
11 ABC+EFV+NFV 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219E K103N, Y181I, G190A   K122KE, D123E, G196E, R211K, V245T, E248D, T286A, E297K, M357T, A376T, T377M, S379C, T386A, K390R, Q394L, A400T, V435I, V458I, R461K, S468T, H483Y, K530R, K558R  
>CA11940| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
IQYMDDLYVASDLEIEQHRTKIEELRQHLLKWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKITMECIVIWGKAPKFRLPILKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYITDKGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSAGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S D60DE, I62V, L63P, A71V, V77I, I93L  
>CA12029| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QVPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005