<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA627 CA1194 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 217
2 DDC 44
3 AZT 39
4 D4T 13
5 3TC+AZT 17
6 3TC+AZT+SQV 13
7 3TC+AZT+IDV 17
8 3TC+D4T 13
9 3TC+D4T+NFV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I15V, E35D, M36I, L63P  
>CA1194| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y       E6D, I31IL, I47IF, R83K, K102KR, K122E, I135IL, S162C, Q207E R72RG
>CA38024| codons 1-249
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTELEKEGKFSKIGPENPYNTPV
FAIKKKDSTKWGKLVDFRELNKKTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEK

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005