<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ASRU011 ASRU011 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 33
2 AZT+DDC+RTV 18
3 AZT+DDC+SQV 8
4 3TC+D4T+IDV 4
5 3TC+AZT+IDV 45
6 D4T+DDI+NVP+NFV 6
7 D4T+NVP+NFV 11
8 D4T+ADV+NVP+NFV 24
9 3TC+ABC+AZT 3
10 Unknown 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q Y181C, G190A   V90I, I135T, T200A, E203K, K223E, L228R I2F
>ASRU011| codons 1-235
PFSPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRAKIKELRQHLLRWGFFTPDQKHQEEPPFRWMGYELH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10I, I15V, E35D, L63P, Q92K, I93L, C95F R87K
>ASRU011| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGKNLMTKLGFTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005