<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ASRU017 ASRU017 U.K. 1999 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+SQV 35
2 3TC+AZT+IDV 52
3 D4T+DDI+RTV+SQV 4
4 D4T+DDI+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_S, T215Y   Y181C, G190A   V35T, K49R, V60I, D121C, K122E, I132X, I135T, D177E, I178M, L205X, Q207E, R211K  
>ASRU017| codons 1-235
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISRIGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
CEDFRKYTAFTXPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVASDLEIGQHRTKIEEXREHLLKWGFYTPDKKHQKEPPFLWMGYELH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, T12S, I15V, K20T, E35G, M36I, R41K, I64V, A71T, I85V, I93L  
>ASRU017| codons 1-99
PQITLWQRPIVSIKVGGQLTEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKTIGTVLVGPTPVNVVGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005