<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ASRU015 ASRU015 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 AZT+ DDC 43
3 3TC+ D4T+ RTV 43
4 3TC+ ADV+ D4T+ RTV 13
5 ADV+ DDI+ NFV 4
6 ADV+ AZT+ DDI+ NFV+ SQV 4
7 ADV+ DDI+ NFV+ SQV 12
8 ADV+ DDI+ NFV+ NVP+ SQV 17
9 DDI+ NFV+ NVP+ SQV 41

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   Y181C, G190A   K20R, E44D, D86E, K101Q, V118I, K122E, S162C, I178L, R211K, E224X  
>ASRU015| codons 1-233
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQEFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKDPPFLWMGYE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M Q58E L10I, L19I, K20R, E35D, M36I, L63P, A71V, V77I, I93L  
>ASRU015| codons 1-99
PQITLWQRPIVTIKIGGQIREALLDTGADDTVLEDINLPGRWKPKLIGGIGGFVKVREYD
QIPIEICGHKVIGTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005