<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ASRU021 ASRU021 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 30
2 3TC+ AZT 39
3 3TC+ D4T+ SQV 78
4 D4T+ NFV+ NVP 56

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M   E35D, M36I, N37D, R57K, L63P, A71T  
>ASRU021| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEDIDLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y   K103N, Y181C   E6D, K20R, K43N, E44D, I50V, E169D, L210S, D218E  
>ASRU021| codons 1-235
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENDGKISKVGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLSRWGFYTPEKKHQKEPPFLWMGYELH

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005