<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ASRU020 ASRU020 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ NFV 30
2 3TC+ AZT+ NVP 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, K20R, N37E, L63P, I93L  
>ASRU020| codons 1-99
PQITLWQRPLVTIKIGGQIREALLDTGADDTVLEEMELPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   K103N   I31L, K101R, S163T, D177E, Q207E  
>ASRU020| codons 1-234
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005