<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ASRU019 ASRU019 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 AZT+ DDC 30
3 AZT 17
4 AZT+ RTV 4
5 AZT 8
6 AZT+ SQV 12
7 3TC+ D4T+ SQV 34
8 DDI+ D4T+ IDV+ NVP 43
9 EFV+ ABC+ IDV+ NFV 4
10 EFV+ IDV+ NFV 2
11 EFV+ IDV+ NFV+ DDI 2
12 3TC+ DDI+ EFV+ IDV+ NFV 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y K219N Y181C, G190A V108I P4X, K20R, E44D, A98S, K101Q, K103R, V118I, K122E, Q207E, R211K Q145D
>ASRU019| codons 1-233
PISXIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLQKRKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYDYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYIDDLYVASDLEIGQHRTKIEELREHLWKWGFYTPDNKHQKEPPFLWMGYE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, V11G, E35G, M36I, Q61E, L63P, A71V, I72V, I93L  
>ASRU019| codons 1-99
PQITLWQRPIGTIKIGGQLKEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFIKVRQYD
EIPIEICGHKVVSTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005