<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ASRU018 ASRU018 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 313
2 AZT+ DDI 91
3 AZT+ DDI+ SQV 34
4 3TC+ D4T+ RTV 4
5 3TC+ D4T+ IDV 13
6 3TC+ D4T+ NFV+ NVP 21
7 ABC+ APV+ AZT+ DDC+ EFV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, L63P, A71V, V77I  
>ASRU018| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFTKVRQYD
QIPIEICGHKVIGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, L74V, L210LW, T215Y K219KQ K101E, Y181C G190R T39A, E44D, V118I, K122E, V189VI, E203X, R211K  
>ASRU018| codons 1-236
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYIRSDLEIGQHRTKIXELRQHLWKWGFYTPDQKHQKEPPFLWMGYELHP

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005