<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ASRU016 ASRU016 U.K. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 3TC+ AZT 39
3 D4T+ DDI 3
4 IDV 4
5 IDV+ NVP 6
6 IDV+ NVP+ SQV 53
7 ABC+ DLV+ NFV 1
8 DLV+ NFV 1
9 NFV 1
10 DLV+ NFV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C K101N K20R, Y56X, S162Y, E169D, T200A, H221L  
>ASRU016| codons 1-235
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENP*NTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLNKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKLQKEPPFLWMGYELH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S I15V, K20V, E35D, N37S, R41K, I62V, L63P, A71X  
>ASRU016| codons 1-99
PQITLWQRPLVTIKVGGQLVEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKXISTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005