<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4826 CA11887 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 34
2 D4T 56
3 AZT+ 3TC 17
4 AZT+ 3TC+ SQV 69
5 AZT+ 3TC+ NFV 74
6 D4T+ DDI+ NFV 38

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M N88D W6WC, I13V, K20R, E35D, M36I, N37ST, R57K, L63P  
>CA11887| codons 1-99
PQITLCQRPLVTVKIGGQLREALLDTGADNTVLEDISLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L210W, T215Y K219Q     K20R, V35I, T39A, E44D, V60I, V118I, K122E, I135T, E203K, H208Y, R211K, D218E, L228H, A272P, I293V, P294A, E297K  
>CA11738| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIKELRQYLWKWGFYTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVALTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005