<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA624 CA1188 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 209
2 3TC+D4T 117
3 3TC+AZT+NFV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13V, E35D, M36I, L63P  
>CA1188| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, Y115F, Q151M, M184EV A62V, V75I, F77L, F116Y     S68G, T69N, K166KR, D177DE, I178M V148VE, Y183Y*
>CA1189| codons 1-187
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDGNGWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNELPMGWKGSPAIFQSSMTRILEPFRKQNPEMVI
YQ*VDDL

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005