<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4816 CA11871 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 24
2 3TC+D4T+NFV 21
3 3TC+DDI+NVP 17
4 DDI+NVP+RTV+SQV 17
5 ABC+EFV+NFV 27
6 3TC+ABC+AZT+IDV+RTV 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M N88D L10I, I13V, K14R, I15V, N37D, K45R, I62V, L63P, V77I, I93L  
>CA11871| codons 1-99
PQITLWQRPIVTVRVGGQLKEALLDTGADNTVLEEMDLPGRWKPRMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V   Y181C, G190GS   V35L, V106I, K122E, K173T, Q174R, T200TA, Q207E, R211K, F214L, H221Y, D237DE, A272P, K277R, I293V, P294AS  
>CA11720| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTRNPDIVI
CQYMDDLYVSSDLEIGQHRAKIEELREHLLKWGLTTPDKKYQKEPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVALTEEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009