<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4797 CA11845 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 61
2 None 57
3 3TC+IDV 22
4 3TC+AZT+IDV 151

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F   L5LF, L10I, L19Q, K20T, K43KN, I64V, A71V, V77I, I85V, I93L D25DV
>CA11845| codons 1-99
PQITFWQRPIVTIKIGGQQTEALLVTGADDTVLEEMNLPGRWNPKIIGGIGGFVKVRQYD
QILVEICGHKVIGTVLIGPTPFNIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215Y       E44D, K122E, T200I, Q207A, R211K, V245M, E248D, D250E, R284K Q269QE, I270IL, K281KE, T286R
>CA11694| codons 1-286
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRAHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKESWTVNDIQKLVGKLNWASELYAGIKVKQLCELLKGR

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005