<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA622 CA1184 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 18
2 AZT+DDC 4
3 AZT+DDI 13
4 3TC+AZT 44
5 3TC+D4T+IDV 22
6 D4T+DDI+IDV 32
7 3TC+D4T+RTV+SQV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IL, V82T, L90M G73S L10I, R41K, K45R, L63P, A71V, V77I, I85V, I93L  
>CA1184| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPRIIGGIGGFLKVRQYD
QIPIEICGHKVISTVLIGPTPTNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y V75A, K219E     V35I, E44D, L109I, V118I, K122E, M164X, I202V, H208Y, R211K, L228H  
>CA1185| codons 1-228
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKLADFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVIDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSXTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQYLWKWGFYTPDEKHQKEPPFH

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005