<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4788 CA11832 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT NA
2 D4T+DDI+NFV NA
3 3TC+ABC+D4T+EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I   N37D, K43R, L63S, A71V, I72T, V75I, V77I, I93L  
>CA11832| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMDLPGRWRPKIIGGIGGFIKVRQYD
QISIEICGHKVTGTILIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, T215F D67G     K11KR, K20R, I135T, S162C, Q174K, Q207E, R211K, A272P, V276I, L283I, R284RK, I293V, P294AE  
>CA11682| codons 1-301
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKGSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIKGTKALTEVVALTEEAE
L

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005