<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1469 CA11831 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+AZT 39
3 3TC+AZT+SQV 17
4 3TC+AZT+IDV 52
5 D4T+DDI+NFV 65
6 3TC+RTV+SQV 18
7 3TC+RTV+SQV 5
8 3TC+EFV+RTV+SQV 9
9 3TC+RTV+SQV 13
10 APV+D4T+RTV+SQV 10

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A   L10I, G16GA, N37D, L63P, A71I, V77I, I93L  
>CA11831| codons 1-99
PQITLWQRPIVTIKIAGQLKEALLDTGADDTVLEEMDLPGRWKPKMIVGIGGFSKVRQYD
QIPIEICGHKIIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219EQ K103KN   V118VI, K122E, I135T, I202V, H208Y, L210LF, R211K, D218E, L228H, V245Q, L283I, T286A, I293V, E297R  
>CA11681| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQYLFKWGFFTPEEKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGAKALTEVVPLTREAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009