<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4781 CA11823 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 25
2 D4T 52
3 DDC 17
4 AZT+3TC 17
5 AZT+3TC+SQV 52
6 AZT+3TC+IDV 104
7 3TC+AZT+NFV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54IV, L90M G73S L10I, K20I, E35EG, M36MI, I62V, L63P, C67CF, A71T, I72X  
>CA11823| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEGINLPGRWKPKIIGGIGGFVKVRQYD
QVPIEIFGHKTXSTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219KN     V21VI, V35M, T39K, K43E, K102R, V118I, G196E, E203K, H208Y, R211K, K223E, L228H, D250E M230MV
>CA11673| codons 1-285
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALMEICKELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIKELRQYLWKWGFYTPDNKHQEEPPFHWVGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRG

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009