<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4754 CA11786 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NFV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D Q7D, L10I, I13V, N37S, L63P, C67S, A71AV, V77I  
>CA11786| codons 1-99
PQITLWDRPIVTVKIGGQLKEALLDTGADNTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEISGHKVIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35M, A98S, I135V, S162N, E169D, T200K, V245M, A272P, Q278H, K281R, E297K, A304G  
>CA11629| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRKKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCRLLRGTKALTEVIPLTKEAE
LELG

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001