<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4751 CA11783 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+D4T+NVP 52
2 D4T+DDC+IDV 49

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IV, V82A L10LF, L24I I64V  
>CA11783| codons 1-99
PQITLWQRPFVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QILVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K101E, G190A   A98S, K122E, D123E, D177E, I178L, V179I, V245E, K277R, T286A, E297K  
>CA11626| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLEKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELII
YQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTKEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005