<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3979 CA11780 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 161
2 3TC+AZT+IDV 13
3 3TC+AZT+SQV 26
4 3TC+AZT+NFV 65
5 3TC+DDI+NVP+RTV+SQV 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84IV, L90M N88ND K20I, E35G, M36I, I62V, L63P, H69NT, A71X, I72V, T74TS  
>CA11780| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGNKXVGSVLVGPTPVNVIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74I, M184V   K103KN   K20R, T69N, R83K, K122E, D123E, D177E, I178M, F214L, V245E, A272P, E297K  
>CA24745| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKIVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
LEL

References
Author Title Citation
Mitsuya, Y N88D facilitates the co-occurrence of D30N and L90M and the development of multidrug resistance in HIV type 1 protease following nelfinavir treatment failure. ARHR, 2006