<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1490 CA11774 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 82
2 D4T 57
3 3TC+AZT 26
4 3TC+AZT+IDV 22
5 3TC+D4T+IDV 35
6 DDI+DLV+NFV 17
7 D4T+RTV+SQV 38
8 3TC+D4T+NFV+SQV 40
9 3TC+ABC+D4T+NFV+SQV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M K43T, F53L, L89V L10V, I13IV, M36I, N37D, K55KR, L63P, A71V K20RS
>CA11774| codons 1-99
PQITLWQRPVVTVKIGGQLREALLDTGADDTILEEIDLPGRWTPKIIGGIGGLIRVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, M184V, T215Y K219Q K103KN   K20R, V106I, I135V, G196E, R211T, F214L, H221Y, I293V  
>CA11616| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLTWGLYTPDQKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009