<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1329 CA11767 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 21
2 3TC+ D4T+ NFV 57
3 SQV+ 3TC+ AZT+ RTV 41
4 3TC+ AZT+ EFV+ SQV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I84V, L90M L33F, K43T, N88D I15V, E35D, M36L, N37E, D60E, I62V, L63P  
>CA11767| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVFEDLELPGRWTPKMIGGIGGFIKVRQYE
QVPIEICGHKAIGTVLVGPTPVNVIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225PH V35R, T39A, K102Q, D123E, I135T, I142V, S162C, T200A, V245T  
>CA39035| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPITLPEK

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005