<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1492 CA11757 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 74
2 DDC+DDI 61
3 AZT+DDC 31
4 DDC 104
5 3TC+D4T 48
6 3TC+NVP 4
7 EFV+IDV 22
8 3TC+AZT+EFV+IDV 51
9 D4T+DDI+NFV+SQV 33
10 D4T+DDI+NFV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M T74P I15V, K43R, Q61E, I62V, L63P, I72V, I93L  
>CA11757| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
EVPIEICGHKAVGPVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       K20R, K122E, D177G, Q207E, R211K, A272P, T286A  
>CA11595| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LEL

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005