<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4828 CA11743 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ AZT+ 3TC 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     V179D E6EA, T27TA, I31L, V90I, K103R, T200I, R211K, F214L, L228H, V245K, I293V  
>CA11743| codons 1-303
PISPIATVPVKLKPGMDGPKVKQWPLAEEKLKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
YQYVDDLYVGSDLEIGQHRIKIEELRQHLLKWGLTTPDKKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54IV, I84IV L10LF E35D, L63P, I72T, I93L  
>CA11890| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKATGTVLVGPTPVNVIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001