<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4822 CA11732 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 D4T 65
3 AZT+ 3TC 39
4 DDI+ NFV+ NVP 108

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   Y181I   K20R, T39A, K122E, I135T, E138A, S162C, V179VI, E203K, R211K, H221HY, D250N  
>CA11732| codons 1-262
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
IQYMDDLYVGSDLEIGQHRTKIKELRQHLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKNSWTVNDIQKLVG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N M46V I15V, E35D, M36V, N37T, K45Q, I64V  
>CA11881| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEDVTLPGRWKPQVIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012