<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1251 CA11729 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDC 26
3 AZT+DDI 65
4 3TC+AZT+D4T 39
5 3TC+D4T+DDI 17
6 3TC+D4T+DDI+SQV 13
7 3TC+RTV+SQV 17
8 3TC+NVP 26
9 3TC+AZT+IDV 8
10 3TC+D4T+RTV+SQV 9
11 3TC+D4T+NVP+RTV+SQV 87
12 3TC+ABC+NVP+RTV+SQV 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E Y188L   V35I, T69N, K122E, V179I, L228H, V245R, A272P, K277R, I293V  
>CA11729| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLLVGSDLEIGQHRTKIEELRQHLLRWGFFTPDEKHQKEPPFHWMGYELHPDKWT
VQPIRLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L33I, N88D L10I, I13V, E35D, M36I, R41K, L63P, I66IF, A71V  
>CA11879| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVIEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEFCGHKVIGTVLVGPTPVNVIGRDLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005