<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HMDR-4 4 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDC 104
3 DDI 21
4 AZT+DDI 30
5 D4T 52
6 3TC+AZT 21
7 3TC+AZT+SQV 30
8 3TC+AZT+RTV+SQV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54T, V82A, L90M I84IM L10LI, N37D, L63P, A71L, V77I, I93L  
>4| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIVGIGGFTKVRQYD
QIPIEICGHKLIGTVLIGPTPANMIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y K219N   A98G K43E, E44A, K64R, R83K, V118I, S163C, G196E, H208Y, R211K, D218E Q161P
>4| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIRKKNSTKWRKIVDFRELNKKTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFPSCMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPENKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Shafer, RW Multiple concurrent reverse transcriptase and protease mutations and multidrug resistance of HIV-1 isolates from heavily treated patients. Ann Intern Med, 1998
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005