<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2103 CA11686 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 313
2 AZT+DDI 52
3 AZT+DDC 52
4 AZT+D4T 52
5 3TC+D4T+SQV 52
6 3TC+D4T+IDV 61
7 3TC+D4T+IDV+SQV 34
8 NFV+NVP 5
9 3TC+EFV+IDV+RTV 33

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215F A62V, K219Q K103N V108I V35L, K122E, K173E, I178L, D218E, L228H, K277R, Q278H, T286A K281KE
>CA11686| codons 1-288
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEKEGKISKIGPENPYNTPV
FVIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDLVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCELLRGAKA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, V82A, L90M   L10I, I15V, E35D, M36I, N37S, R41K, L63P, A71V, I93L  
>CA11837| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDISLPGKWKPKMIVGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005