<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HMDR-3 3-896 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 86
3 SQV 25
4 3TC+AZT+DDI 43
5 3TC+D4T+IDV 21
6 RTV+SQV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54IT, V82A   L10I, R41K, Q61H, I62V, L63Q, A71V, T74A, V77I, I93L  
>3-896| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIVGIGGFTKVRQYD
HVQIEICGHKVIGAVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210W, T215Y       V35I, K43N, V60I, A98S, V118I, K122X, I135V, G196X, Q207E, R211K, V245L  
>3-896| codons 1-254
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELENEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DXDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIXQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTV

References
Author Title Citation
Shafer, RW Multiple concurrent reverse transcriptase and protease mutations and multidrug resistance of HIV-1 isolates from heavily treated patients. Ann Intern Med, 1998
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005