<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HMDR-3 HMDR3-395 U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 86
3 SQV 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V   R41K, Q61H, I62V, L63H, A71V, T74A, V77I, I93L  
>HMDR3-395| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIVGIGGFIKVRQYD
HVHIEICGHKVIGAVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Schapiro, JM The effect of high-dose saquinavir on viral load and CD4+ T-cell counts in HIV-infected patients. Ann Intern Med, 1996
Shafer, RW Multiple concurrent reverse transcriptase and protease mutations and multidrug resistance of HIV-1 isolates from heavily treated patients. Ann Intern Med, 1998
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005