<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1601 CA11594 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ DDC+ AZT 17
2 IDV+ D4T+ 3TC 87
3 EFV+ DDI+ ADV 25

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   L100I, K103N   V35M, T39A, R83K, G196E, T200A  
>CA11594| codons 1-260
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73S L10I, K20I, N37D, I62V, L63P, A71T, I72K, V77I  
>CA11756| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKTKSTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005