<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HMDR-2 2-197 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+DDI 52
3 AZT+DDC 52
4 DDC+SQV 21
5 3TC+DDC+SQV 30
6 3TC+D4T+DDC+SQV 52
7 3TC+D4T+DDC+RTV 21
8 D4T+DDI+IDV+SQV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, N37T, R41K, I62V, L63P, H69Y, A71V, T74S, V77I  
>2-197| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMTLPGKWKPKMIVGIGGFTKVRQYD
QVPIEICGYKVIGSVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       T39K, K43E, E44D, V60I, K102Q, V118I, K122E, Q207E, R211K, V245E  
>2-197| codons 26-245
LTEEKIKALVEICKELEEDGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQ
DFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEEL
REHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIE

References
Author Title Citation
Shafer, RW Multiple concurrent reverse transcriptase and protease mutations and multidrug resistance of HIV-1 isolates from heavily treated patients. Ann Intern Med, 1998
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005