<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4725 CA11587 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 96
2 D4T+DDI 26
3 3TC+AZT+IDV 74
4 3TC+AZT+NFV 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y     A98G V35I, E44D, V60I, R83K, V118I, K122E, D123N, I135M, D177E, I178L, R211K, V245E, A272P, K277R, I293V, E297A L295LP, E300EV
>CA11587| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKKTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPPTAEAV
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   T12R, L19I, N37D, I62V, V77I  
>CA11748| codons 1-99
PQITLWQRPLVRIKIGGQIKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QVLIEICGHKAIGTVLIGPTPVNIIGRSLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Rhee, SY Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012