<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3714 P3714-941 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ RTV 18
2 3TC+ AZT+ IDV+ RTV 39
3 D4T+ DDC+ IDV+ SQV 25
4 DDI+ IDV+ NFV+ NVP 14

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74LV, M184V, L210W, T215Y F116Y Y181I   E44D, E53G, K122E, I135V, S162C, I178M, T200A, Q207E, R211K E42EA
>P3714-941| codons 30-236
KIKALVEICTELAKDGKISKIGPGNPYNTPVFAIKKKDSDKWRKVVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYYSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVL
PQGWKGSPAIFQCSMTKILEPFRKQNPDMVIIQYVDDLYVGSDLEIGQHRAKIEELREHL
WKWGFYTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003