<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HMDR-1 1-896-6B U.S. 1996 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+DDI 73
3 AZT+DDC 135
4 3TC+AZT 52
5 D4T+DDI 21
6 D4T+DDI+SQV 30
7 3TC+D4T+SQV 13
8 3TC+AZT+IDV 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       K20R, V21I, V35I, K43E, E44A, K102Q, V118I, K122E, I135T, G196E, L205F, H208Y, R211K, E224D, A272P, I293V  
>1-896-6B| codons 1-303
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALIEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEEFRQYLWKWGFYTPDKKHQKDPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, L63H, A71V, V77I  
>1-896-6B| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFTKVRQYD
QIHIEICGHKVIGTVLIGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Multiple concurrent reverse transcriptase and protease mutations and multidrug resistance of HIV-1 isolates from heavily treated patients. Ann Intern Med, 1998
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005