<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-7891 P7891-1259 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ DDC+ SQV 71
2 3TC+ DDC 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, N37T, R41K, L63LP, A71V, I72V, V77I  
>P7891-1259| codons 1-93
PQITLWQRPLVSIKIGGQLKEALLDTGADDTVLEEMTLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVVGTVLIGPTPVNIIGRNLLTQI

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       I135V, S162A, T200A, Q207E, R211K  
>P7891-1259| codons 22-236
KQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPG
IRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAK
IEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005