<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5577 P5577-906 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ D4T 76
2 3TC+ DDC+ IDV 44
3 DDC+ RTV+ SQV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, K14R, N37Y, R41K, I62V, L63P, V77I  
>P5577-906| codons 1-92
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMYLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAISTVLIGPTPVNVIGRNLMTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y       K122E, I135V, S162G, E203D, Q207D, R211K  
>P5577-906| codons 31-236
IKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEV
QLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLP
QGWKGSPAIFQGSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIDELRDHLW
KWGFYTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003