<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5577 P5577-675 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ D4T 76
2 3TC+ DDC+ IDV 44
3 DDC+ RTV+ SQV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, K14R, N37Y, R41K, I62V, L63P, V77I, I93L  
>P5577-675| codons 7-99
QRPIVTIRIGGQLKEALLDTGADDTVLEEMYLPGKWKPKMIGGIGGFIKVRQYDQVPIEI
CGHKAISTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005