<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-4651 P4651-319 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 20
2 3TC+ AZT 38
3 3TC+ D4T 12
4 3TC+ DDI+ IDV 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I N37S, I62V, L63S, I64L, A71V, V77I  
>P4651-319| codons 1-92
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QVSLEICGHKVIGTVLIGPTPVNIIGRNLLTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y K219N     V35M, T39A, K43E, E44D, D123E, K166R, D177E, I202V, E203D, H208Y, R211K  
>P4651-319| codons 30-237
KIKALMEICAELEEDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTRILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKVDELRQYL
WKWGFYTPDNKHQKEPPFLWMGYELHPD

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003