<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-4520 P4520-1146 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 NRTI 186
3 3TC+ AZT 8
4 3TC+ D4T+ IDV 81
5 3TC+ AZT+ IDV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, N37S, K45R, I62V, L63T, V77I  
>P4520-1146| codons 1-92
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPRMIGGIGGFIKVRQYD
QVTIEICGHKAIGTVLIGPTPVNIIGRNLLTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, I135T, I178M, R211S  
>P4520-1146| codons 30-236
KIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRTKIEELRQHL
LSWGFTTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003