<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3927 P3927-942 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 NRTI 137
3 3TC+ RTV+ SQV 61
4 D4T+ NVP+ RTV+ SQV 42

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37D, K43R, I62V, L63P, V77I  
>P3927-942| codons 1-92
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWRPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215Y       K103X, D123E, I135T, I180X, Q207E, R211K, K223E  
>P3927-942| codons 31-237
IKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEV
QLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLP
QGWKGSPAIFQSSMTKILEPFRKQNPDIVMYQYVDDLYVGSDLEIGQHRTKIEELREHLW
KWGFYTPDKKHQEEPPFLWMGYELHPD

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003