<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3926 P3926-732 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 12
2 3TC+ AZT 49
3 3TC+ AZT+ SQV 22
4 3TC+ D4T+ IDV 6
5 DDI+ RTV+ SQV 19
6 D4T+ DDC+ NFV+ NVP 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A   L10I, I15V, Q18IL, M36I, N37D, I62V, L63Q, A71V, T74S, I93X  
>P3926-732| codons 1-93
PQITLWQRPIVTIKVGGILKEALLDTGADDTVLEEIDLPGRWKPKMIVGIGGFVKVRQYD
QVQIEICGHKVIGSVLVGPTPANIIGRNLLTQF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215Y K219R Y181C, G190A   E44D, V118I, K122E, S162C, R211K, L228R  
>P3926-732| codons 31-236
IKALVEICTELEKDGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFRELNKRTQDFWEV
QLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLP
QGWKGSPAIFQCSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRQHLW
KWGFYTPDRKHQKEPPFRWMGYELHP

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003