<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3926 P3926-623 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 12
2 3TC+ AZT 49
3 3TC+ AZT+ SQV 22
4 3TC+ D4T+ IDV 6
5 DDI+ RTV+ SQV 19
6 D4T+ DDC+ NFV+ NVP 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A   L10I, K14R, I15V, Q18L, M36I, N37D, L63Q, A71V, Q92P, I93L R87K
>P3926-623| codons 7-98
QRPIVTIRVGGLLKEALLDTGADDTVLEEIDLPGRWKPKMIVGIGGFVKVRQYDQIQIEI
CGHKVIGTVLVGPTPANIIGKNLLTPLGCTLN

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005