Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SWC-3926 | P3926-623 | U.S. | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDC | 12 |
| 2 | 3TC+ AZT | 49 |
| 3 | 3TC+ AZT+ SQV | 22 |
| 4 | 3TC+ D4T+ IDV | 6 |
| 5 | DDI+ RTV+ SQV | 19 |
| 6 | D4T+ DDC+ NFV+ NVP | 7 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48V, I54V, V82A | L10I, K14R, I15V, Q18L, M36I, N37D, L63Q, A71V, Q92P, I93L | R87K |
| >P3926-623| codons 7-98 QRPIVTIRVGGLLKEALLDTGADDTVLEEIDLPGRWKPKMIVGIGGFVKVRQYDQIQIEI CGHKVIGTVLVGPTPANIIGKNLLTPLGCTLN |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |