<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3834 P3834-641 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ DDC+ IDV 38
2 RTV+ SQV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48GV, I54IV, V82A, L90M   L10I, L19I, E35D, M36X, N37E, L63C  
>P3834-641| codons 1-92
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEDIELPGRWKPKIIVGIGGFVKVRQYD
QICIEICGHKAIGTVLVGPTPANIIGRNLMTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R83K, K122Q, I178L, T200A, Q207E, R211K  
>P3834-641| codons 34-239
LVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLG
IPHPAGLKKKKSVTVLDVGDAYFSVPLDQDFRKYTAFTIPSINNETPGIRYQYNVLPQGW
KGSPAIFQSSMTKILEPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWG
FTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005