<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3395 P3395-1753 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 NRTI 24
3 3TC+ AZT+ IDV 51
4 D4T+ RTV+ SQV 30
5 D4T+ DDI+ NFV+ NVP 4
6 3TC+ D4T+ DDI+ NFV 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M   L5X, L10I, L19I, E35D, N37D, L63P, I64V, V77I, I93L  
>P3395-1753| codons 1-99
PQITXWQRPIVTIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFVKVRQYD
QIPVEICGHKAIGTVLIGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K122E, T165L, I167X, E169X, I178M, K201T, R211K  
>P3395-1753| codons 22-233
KQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPAIFQSSMLKMLDPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTT
IEELRQHLLKWGFYTPDKKHQKEPPFLWMGYE

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003