<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3395 P3395-1201 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 NRTI 24
3 3TC+ AZT+ IDV 51
4 D4T+ RTV+ SQV 30
5 D4T+ DDI+ NFV+ NVP 4
6 3TC+ D4T+ DDI+ NFV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M   L10I, L19I, E35D, N37D, L63P, V77I  
>P3395-1201| codons 1-92
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLIGPTPFNIIGRNLMTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       K122E, T165L, I178M, R211K  
>P3395-1201| codons 30-236
KIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMLKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRTKIEELRQHL
LKWGFYTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005